Round 2

Round 1 finished with 700+ designs submitted and 200 of them being tested through Adaptyv Bio’s lab. Use the newly generated data and evaluate on a retrospective benchmark to inform your designs ahead of your submission for Round 2. Same target, more data, who will win?

EGFR

Organism HUMAN

Accession ID P00533

Epidermal Growth Factor Receptor (EGFR) is a transmembrane protein that plays a critical role in cell growth, differentiation, and survival. It is frequently overexpressed or mutated in various cancers, including non-small cell lung cancer, colorectal cancer, and head and neck cancer. This makes EGFR a crucial target for cancer therapies such as Cetuximab, an antibody with more than 1B USD in annual revenue.

LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKII

Prizes

In partnership with the AIDrugX Workshop at NeurIPS 2024, the top designer will be given a 15-minute presentation slot to describe their design approach.

1st Place

Speaking slot at NeurIPS + $5K cash

2nd Place

$3K cash

3rd Place

$1K cash

In addition, the top 5 designers with the best binding affinity (= lowest KD value) will receive 10 free assays each to run at Adaptyv Bio for their own protein design campaigns.

Top 10 designers will additionally receive an Adaptyv Bio & Polaris Merch Pack